Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0151500_circ_g.4 |
| ID in PlantcircBase | osa_circ_008478 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 2415823-2416224 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0151500 |
| Parent gene annotation |
Major facilitator superfamily protein. (Os11t0151500-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0151500_circ_g.2 Os11g0151500_circ_g.3 Os11g0151500_circ_g.5 Os11g0151500_circ_g.6 Os11g0151500_circ_g.7 Os11g0151500_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0151500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114220564 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2415968-2415829(+) 2416189-2415875(+) 2415964-2416178(-) |
| Potential amino acid sequence |
MTEEINKATETWKIHRSGRNLEKPLPRACEADSIPVMQPNANALFDGSTTSAFS*(+) MQMLSLMDQPHRPSPDYVNILLDRLPAPQW*(+) MKISLVETLQRASSGSFEHMSFSSLVVRLPLRRWESIKENINIIRRRPMWLIHQREHLHLAA*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |