Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d030132_circ_g.1 |
ID in PlantcircBase | zma_circ_006592 |
Alias | Zm01circ00088 |
Organism | Zea mays |
Position | chr1: 108201243-108201903 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d030132 |
Parent gene annotation |
4-coumarate--CoA ligase-like 6 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d030132_T002:3 Zm00001d030132_T001:3 Zm00001d030132_T005:3 Zm00001d030132_T004:3 Zm00001d030132_T003:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083478363 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
108201891-108201767(+) 108201881-108201278(+) |
Potential amino acid sequence |
MIQVTCLATYSITCVHDRPLPDFLTTKATGTSPASSSSVDVTATSTIPGCSIKTASKSAGAI*( +) MDQHDSSNLLSYILHHLRAR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |