Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d030132_circ_g.1 |
| ID in PlantcircBase | zma_circ_006592 |
| Alias | Zm01circ00088 |
| Organism | Zea mays |
| Position | chr1: 108201243-108201903 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d030132 |
| Parent gene annotation |
4-coumarate--CoA ligase-like 6 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d030132_T002:3 Zm00001d030132_T001:3 Zm00001d030132_T005:3 Zm00001d030132_T004:3 Zm00001d030132_T003:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083478363 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
108201891-108201767(+) 108201881-108201278(+) |
| Potential amino acid sequence |
MIQVTCLATYSITCVHDRPLPDFLTTKATGTSPASSSSVDVTATSTIPGCSIKTASKSAGAI*( +) MDQHDSSNLLSYILHHLRAR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |