Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0100200_circ_g.3 |
| ID in PlantcircBase | osa_circ_035509 |
| Alias | Os_ciR11489 |
| Organism | Oryza sativa |
| Position | chr8: 23363-23610 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0100200 |
| Parent gene annotation |
Similar to ZIP transporter. (Os08t0100200-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0100200-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242738609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23583-23560(+) 23594-23365(-) |
| Potential amino acid sequence |
MLNMSPVAKPCLSFSSAKLQSGSGKTSAIVENRSAPAKNQRFPFRKPIALTAS*(+) MLSMSFFDLAYDAVNAIGFLKGNLWFFAGALLFSTIAEVFPEPDCNLADENDKHGFATGLMLSM SFFDLAYDAVNAIGFLKGNLWFFAGALLFSTIAEVFPEPDCNLADENDKHGFATGLMLSMSFFD LAYDAVNAIGFLKGNLWFFAGALLFSTIAEVFPEPDCNLADENDKHGFATGLMLSMSFFDLAYD AVNAIGFLKGNLWFFAGALLFSTIAEVFPEPDCNLADENDKH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |