Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0320700_circ_g.1 |
| ID in PlantcircBase | osa_circ_030698 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 12458670-12460823 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0320700 |
| Parent gene annotation |
Uncharacterised protein family UPF0061 domain containing protein . (Os06t0320700-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0320700_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0320700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253898124 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12460641-12458730(+) 12460468-12460609(-) |
| Potential amino acid sequence |
MNQTGVHHSTGHKVNSQPKDLLLRTAEENQVFQTCIFVRSKIYRWRVPYSCFKR*(+) MHGLGIPTTRALCLVETGKSVVRDMFYDGNSKEEPGAIVCRVAPSFLRFGSYQIHATRDKEDLE IVRHLADYTIRHHYPHLENIKKSEGLSFEAAIGDSPAIDLTSNKYAGLKDLIFLSCSQEQILWL GVHLMPSAMVDTSLVHGLVSWATDEQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |