Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043805_circ_g.4 |
ID in PlantcircBase | zma_circ_007823 |
Alias | zma_circ_0001325 |
Organism | Zea mays |
Position | chr3: 210590952-210591346 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d043805 |
Parent gene annotation |
zinc finger protein-related |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d043805_T018:2 Zm00001d043805_T002:2 Zm00001d043805_T008:2 Zm00001d043805_T003:2 Zm00001d043805_T004:2 Zm00001d043805_T017:2 Zm00001d043805_T005:2 Zm00001d043805_T013:2 Zm00001d043805_T012:2 Zm00001d043805_T020:2 Zm00001d043805_T021:2 Zm00001d043805_T010:2 Zm00001d043805_T022:2 Zm00001d043805_T001:2 Zm00001d043805_T009:2 Zm00001d043805_T011:2 Zm00001d043805_T007:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.346880802 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
210591026-210590975(+) 210591023-210591317(-) |
Potential amino acid sequence |
MKCNCCLGMKLTEHKCREKGLETNCPICCDFLFTSSAAVRALPCGHFMHSACFQAYTCSHYTCP ICCKSLGDMADCVPLPVL*(+) MKEINTKTFPKTTQITKRAVVHSPPYLPEICSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |