Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G26890_circ_g.1 |
ID in PlantcircBase | ath_circ_023983 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 9908348-9908428 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G26890 |
Parent gene annotation |
AT3G26890 protein |
Parent gene strand | - |
Alternative splicing | AT3G26890_circ_g.2 AT3G26890_circ_g.3 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G26890.3:1 AT3G26890.8:1 AT3G26890.7:1 AT3G26890.1:1 AT3G26890.2:1 AT3G26890.4:1 AT3G26890.6:1 AT3G26890.5:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.232516667 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9908366-9908350(-) |
Potential amino acid sequence |
MPAGTKVLSNPEKTPLHTFLCNYDLTDMPAGTKVLSNPEKTPLHTFLCNYDLTDMPAGTKVLSN PEKTPLHTFLCNYDLTDMPAGTK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |