Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0245800_circ_g.3 |
| ID in PlantcircBase | osa_circ_030363 |
| Alias | Os06circ06471 |
| Organism | Oryza sativa |
| Position | chr6: 7578267-7579187 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os06g0245800 |
| Parent gene annotation |
Similar to Alanyl-tRNA synthetase. (Os06t0245800-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0245800_circ_g.1 Os06g0245800_circ_g.2 Os06g0245800_circ_g.4 |
| Support reads | 2/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0245800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006618* osi_circ_016856 |
| PMCS | 0.323892581 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7578815-7578979(+) |
| Potential amino acid sequence |
MRLRLSRVSPILNFWDRTPFYAESGGQVGDNGFLYVYGEEDAKQKAVIEINDVQKSLGNIFVHK GTIKQGSVEVGKEIDAAVDAKLRQGAKIIGDHMRAVVYLISDGVIPSNIGRGYVVRRLIRRVVR TGRLIGIRGDGHGNSEGAFLPSLAEVAISLSTEIDPDVESRRKSILGELQREELRFVQTLERGE KLLDELLDEALSSAGNNGGKPCLSGKDVFLLYDTYGFPVEITAEISGERGVIVDMKGFDMEMEN QRKQSQAAHNVVKLSVGNETEIVKSIPDTEFLGSDTILC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |