Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0245800_circ_g.3 |
ID in PlantcircBase | osa_circ_030363 |
Alias | Os06circ06471 |
Organism | Oryza sativa |
Position | chr6: 7578267-7579187 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os06g0245800 |
Parent gene annotation |
Similar to Alanyl-tRNA synthetase. (Os06t0245800-01) |
Parent gene strand | + |
Alternative splicing | Os06g0245800_circ_g.1 Os06g0245800_circ_g.2 Os06g0245800_circ_g.4 |
Support reads | 2/1 |
Tissues | leaf/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0245800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006618* osi_circ_016856 |
PMCS | 0.323892581 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7578815-7578979(+) |
Potential amino acid sequence |
MRLRLSRVSPILNFWDRTPFYAESGGQVGDNGFLYVYGEEDAKQKAVIEINDVQKSLGNIFVHK GTIKQGSVEVGKEIDAAVDAKLRQGAKIIGDHMRAVVYLISDGVIPSNIGRGYVVRRLIRRVVR TGRLIGIRGDGHGNSEGAFLPSLAEVAISLSTEIDPDVESRRKSILGELQREELRFVQTLERGE KLLDELLDEALSSAGNNGGKPCLSGKDVFLLYDTYGFPVEITAEISGERGVIVDMKGFDMEMEN QRKQSQAAHNVVKLSVGNETEIVKSIPDTEFLGSDTILC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |