Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042720_circ_g.5 |
ID in PlantcircBase | zma_circ_007727 |
Alias | Zm03circ00068, GRMZM2G149617_C1 |
Organism | Zea mays |
Position | chr3: 178138849-178140498 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d042720 |
Parent gene annotation |
Sterol 3-beta-glucosyltransferase |
Parent gene strand | - |
Alternative splicing | Zm00001d042720_circ_g.1 Zm00001d042720_circ_g.2 Zm00001d042720_circ_g.3 Zm00001d042720_circ_g.4 Zm00001d042720_circ_g.6 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d042720_T005:4 Zm00001d042720_T004:4 Zm00001d042720_T011:4 Zm00001d042720_T009:4 Zm00001d042720_T007:4 Zm00001d042720_T003:4 Zm00001d042720_T008:4 Zm00001d042720_T010:4 Zm00001d042720_T006:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.080412511 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
178139869-178140486(-) |
Potential amino acid sequence |
MPQSATYRLSYLILDLIVWWGSRGFINDFRKKLNLPPIAYFSTYHGSISHLPTGYMWSPQLMPK PKDWGPLVDVVGYCFLNLGTKYQPPPQLSQWLQQGPKPIYIGFGSMVIYT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |