Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0744400_circ_g.2 |
| ID in PlantcircBase | osa_circ_003849 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 31121939-31127450 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0744400 |
| Parent gene annotation |
Similar to Isoform 2 of Golgin candidate 1. (Os01t0744400-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0744400_circ_g.1 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0744550-00:3 Os01t0744400-01:3 Os01t0744550-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133710057 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31127437-31121941(-) |
| Potential amino acid sequence |
MRVEMAGMKRDAEHYSRQEHVELEKRYRELTDLLYHKQTQLESMASEKAALEFQLEKSIKQFHE VQAELQKMRVEMAGMKRDAEHYSRQEHVELEKRYRELTDLLYHKQTQLESMASEKAALEFQLEK SIKQFHEVQAELQKMRVEMAGMKRDAEHYSRQEHVELEKRYRELTDLLYHKQTQLESMASEKAA LEFQLEKSIKQFHEVQAELQKMRVEMAGMKRDAEHYSRQEHVELEKRYRELTDLLYHKQTQLES MASEKAALEFQLEKSIKQFHEVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |