Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G31910_circ_g.4 |
ID in PlantcircBase | ath_circ_005325 |
Alias | AT1G31910_C1, AT1G31910_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 11459003-11459522 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G31910 |
Parent gene annotation |
Phosphomevalonate kinase, peroxisomal |
Parent gene strand | + |
Alternative splicing | AT1G31910_circ_g.2 AT1G31910_circ_g.3 AT1G31910_circ_g.5 AT1G31910_circ_g.6 AT1G31910_circ_g.7 AT1G31910_circ_g.8 AT1G31910_circ_g.9 AT1G31910_circ_g.10 AT1G31910_circ_g.11 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GC-AG |
Number of exons covered | AT1G31910.1:3 AT1G31910.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185105656 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11459051-11459003(+) |
Potential amino acid sequence |
MAVVASAPGKVLMTGGYLVLEKPNAGLVLSTNARFYAIVKPINEEVKPESWAWKWTDVKLTSPQ LSRESMYKLSLNHLTLQSVSAR* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |