Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G31910_circ_g.4 |
| ID in PlantcircBase | ath_circ_005325 |
| Alias | AT1G31910_C1, AT1G31910_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 11459003-11459522 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G31910 |
| Parent gene annotation |
Phosphomevalonate kinase, peroxisomal |
| Parent gene strand | + |
| Alternative splicing | AT1G31910_circ_g.2 AT1G31910_circ_g.3 AT1G31910_circ_g.5 AT1G31910_circ_g.6 AT1G31910_circ_g.7 AT1G31910_circ_g.8 AT1G31910_circ_g.9 AT1G31910_circ_g.10 AT1G31910_circ_g.11 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GC-AG |
| Number of exons covered | AT1G31910.1:3 AT1G31910.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185105656 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11459051-11459003(+) |
| Potential amino acid sequence |
MAVVASAPGKVLMTGGYLVLEKPNAGLVLSTNARFYAIVKPINEEVKPESWAWKWTDVKLTSPQ LSRESMYKLSLNHLTLQSVSAR* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |