Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA006922_circ_g.3 |
ID in PlantcircBase | osi_circ_003732 |
Alias | 2:6606465|6609174 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 6606465-6609174 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA006922 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA006922_circ_g.1 BGIOSGA006922_circ_g.2 BGIOSGA006922_circ_g.4 BGIOSGA006922_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA006922-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_013715* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6609056-6609173(-) |
Potential amino acid sequence |
MVVSILGKVWAYEENDECSFVQDLFSMMQFLFSLDIGSLNFMQSSNMIENQKSELIVFGLCFSL ISYLYVLATKKDMRFQISYDDTTEGQQQPTLQLISDLLNSITVAMERVAEEKYMLLNKIRDLNE LSRKEVDDIIKLCMKQDCISPNDNIRKR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | leaf senescence |
Other Information | |
---|---|
References | Huang et al., 2021 |