Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0152700_circ_g.5 |
| ID in PlantcircBase | osa_circ_008489 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 2467111-2468339 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0152700 |
| Parent gene annotation |
Similar to Transcription factor HBP-1b(C38) (Fragment). (Os11t01 52700-01);Similar to Transcription factor HBP-1b(C38) (Fragment) . (Os11t0152700-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0152700_circ_g.4 Os11g0152700_circ_g.6 Os11g0152700_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0152700-02:3 Os11t0152700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124700827 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2468233-2468327(-) |
| Potential amino acid sequence |
MGEASSSSGHPRQNPHVLGYGFHGAMPNSLPSANLFEQQGGANYFGELEEALMQQVATLRRTQQ TATTTSTLHHGDTTPFSTTATAAATARPPPTLDIFPSWPMRSLHTPKKPDC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |