Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA032597_circ_g.2 |
ID in PlantcircBase | osi_circ_002754 |
Alias | 10:4153562|4154206 |
Organism | Oryza sativa ssp. indica |
Position | chr10: 4153562-4154206 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA032597 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA032597_circ_g.2 BGIOSGA032597_circ_igg.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA032597-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4153944-4154200(-) |
Potential amino acid sequence |
MQHHNGGHQRYTNDPSDKIDKLPESSIVLLKQSQQHVFLCQVSALSDFSAVTLLYTMLY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |