Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G57230_circ_g.2 |
| ID in PlantcircBase | ath_circ_027930 |
| Alias | At_ciR2499 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21179567-21180087 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G57230 |
| Parent gene annotation |
Agamous-like MADS-box protein AGL16 |
| Parent gene strand | + |
| Alternative splicing | AT3G57230_circ_g.3 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G57230.2:2 AT3G57230.1:2 AT3G57230.5:2 AT3G57230.4:2 AT3G57230.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14059613 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21179992-21180084(+) |
| Potential amino acid sequence |
MMGEELSGLSVEALQNLENQLELSLRGVRMKKFWQKEAAILKRQLHNLQENHRQMMGEELSGLS VEALQNLENQLELSLRGVRMKKFWQKEAAILKRQLHNLQENHRQMMGEELSGLSVEALQNLENQ LELSLRGVRMKKFWQKEAAILKRQLHNLQENHRQMMGEELSGLSVEALQNLENQLELSLRGVRM KK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |