Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0201700_circ_g.2 |
| ID in PlantcircBase | osa_circ_000770 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 5561268-5561527 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0201700 |
| Parent gene annotation |
Similar to M23 protein (Fragment). (Os01t0201700-01);Transcripti on factor, Floral organ development, Lodicule development, Stam en specification, Floral meristem determinacy, Male reproductive development (Os01t0201700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0201700-02:2 Os01t0201700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.219034679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5561341-5561383(-) |
| Potential amino acid sequence |
MSLRDLKQVENRLEKGIAKIRARKHYQQESSKLRQQISSLQNANSLTRLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |