Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G286900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000896 |
| Alias | Chr08:56235971|56236263 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 56235971-56236263 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G286900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G286900.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.695970933 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
56236229-56236197(-) 56236217-56236055(+) |
| Potential amino acid sequence |
MHLHWKHRELVKLISKQKVLAFVEDSARLLEYESGGILVAIERVPKGYALIYYRGKNYRRPISI RPRNLLTKAKALKRSVAMQRHEVFVVFSMVLLKICICIGSTENL*(-) MQMHIFNNTIENTTNTSWRCIATERFNAFAFVRRFLGLMLMGRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |