Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0565200_circ_g.2 |
| ID in PlantcircBase | osa_circ_020466 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 20381102-20384700 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0565200 |
| Parent gene annotation |
Haloacid dehalogenase-like hydrolase domain containing protein. (Os03t0565200-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0565200_circ_g.1 Os03g0565200_circ_g.3 Os03g0565200_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0565200-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.10902829 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20382438-20381108(+) 20382548-20384645(-) |
| Potential amino acid sequence |
MTAYFSKMGWPAKAPKTDDERKEFIASLHKRKTELFMALIEKKLLPLRPGVQRLIDEALGKGVK VAVCSTSNEKAVSAIVSCLLGPDRAEKITIFAGDVVPRKKPDPAIYLLAATTLGVDPSSCVVVE DSTIGLAAAKAAGMKCIVTKSGGN*(+) MNNSVFLLCSEAINSFLSSSVFGALAGHPILLKYAVILSFPPPILSNSPYSSTSQLTPNSLRFL LRYTSYQQLWLLQAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |