Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G02900_circ_g.3 |
| ID in PlantcircBase | ath_circ_029476 |
| Alias | AT4G02900_C1, AT4G02900_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 1286618-1286942 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G02900 |
| Parent gene annotation |
Hyperosmolality-gated Ca2+ permeable channel 1.7 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G02900.4:1 AT4G02900.1:1 AT4G02900.2:1 AT4G02900.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.594749487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1286650-1286707(+) |
| Potential amino acid sequence |
MKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFATSEPRIQ FYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQDPENSWCVNPNEGHIFHHIYHGRWLGWHSS * |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |