Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0163000_circ_g.1 |
| ID in PlantcircBase | osa_circ_032857 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 3364114-3369664 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0163066 |
| Parent gene annotation |
Hypothetical protein. (Os07t0163066-00) |
| Parent gene strand | + |
| Alternative splicing | Os07g0163000_circ_g.2 Os07g0163000_circ_g.3 Os07g0163000_circ_g.4 Os07g0163000_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0163000-01:14 Os07t0163066-00:13 Os07t0163000-01:14 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.099418485 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3369597-3364119(+) 3369445-3364133(+) 3364568-3369475(-) |
| Potential amino acid sequence |
MNSLGTRFRSPRTTSSVLSLPPTLP*(+) MVVPLLVVHRQVLPEEGSELVDELVGHALPLPAHHQLGALLAPDPSIERAV*(+) MPHICLFMQDVCVPLSRLAECISVSKEKLDASPLTCLVIAHAGDGNFHTIILFDPSQEDQRREA ERLNHFMVHTALSMEGSGARRAPSWWCAGSGSACPTSSSTSSLPSSGRT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |