Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G089500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000055 |
| Alias | Chr01:9720247|9720637 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 9720247-9720637 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G089500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 15 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G089500.2:2 Gorai.001G089500.3:2 Gorai.001G089500.1:2 Gorai.001G089500.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000076* ghi_circ_000101* |
| PMCS | 0.627496569 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9720369-9720633(-) 9720416-9720608(-) 9720561-9720256(+) |
| Potential amino acid sequence |
MAESVQVMGSFDGWSQGEHLSPEFTGSFTTFSTTLFLRPGRH*(-) MWMPSNPRKYPYSGVAWPRAYKLWGHSTDGVKGNTYHQSSPVHSPRSPPHYFLDPAGISLASRR NI*(-) MYLPLIFLEPCGMPALDISSASKTNACRV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |