Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0207101_circ_g.1 |
| ID in PlantcircBase | osa_circ_006426 |
| Alias | Os_ciR6984 |
| Organism | Oryza sativa |
| Position | chr10: 7575678-7575884 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0206800 |
| Parent gene annotation |
Multidrug and toxic compound extrusion (MATE) protein, Al-induce d secretion of citrate (Os10t0206800-01);Similar to predicted pr otein. (Os10t0206800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0207101-00:1 Os10t0207101-00:1 Os10t0206800-02:1 Os10t0206800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247455717 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7575826-7575821(+) 7575861-7575881(+) |
| Potential amino acid sequence |
MARMNSMFQTVKWKSWFLMKAQLNLQLLVYLLPCLIKYQGLQYFPLSVSRHHLLRRKMLHPVTE KNMK*(+) MEELVSHEGPVELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDATSSDREKYEINGENEFN VSDSEMEELVSHEGPVELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDATSSDREKYEING ENEFNVSDSEMEELVSHEGPVELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDATSSDREK YEINGENEFNVSDSEMEELVSHE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |