Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0341700_circ_g.6 |
| ID in PlantcircBase | osa_circ_036789 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 15394264-15396117 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0341700 |
| Parent gene annotation |
Similar to Phosphatidylinositol transfer-like protein II. (Os08t 0341700-01);Similar to predicted protein. (Os08t0341700-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0341700_circ_g.4 Os08g0341700_circ_g.5 Os08g0341700_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0341700-02:1 Os08t0341700-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19915329 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15394308-15394275(+) |
| Potential amino acid sequence |
MWAEMLQWRKEFGADTILEDFNFEELDEVLVYYPQGYHGVDRQGRPVYIERLGKVEPNKLMHIT TVDRYMKYHVQEFERAFHEKFPACSIAAKRHIDSTTTILDVDGVGLKNFSKTARDMLGRMQKID SDYYPETLHQMFVVNAGNGFKLLWNTVKGFLDPKTASKIHVLGTKFHGKLLEVIDASQLPEFLG GACTCAAEGGCLKSNKGPWNDPNIMKLAHNKEAKFTRHTRRLSEIEQRRGSFARLHLLKVFEG* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |