Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0109600_circ_g.3 |
| ID in PlantcircBase | osa_circ_006115 |
| Alias | Os_ciR6979 |
| Organism | Oryza sativa |
| Position | chr10: 678053-678218 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0109600 |
| Parent gene annotation |
Peroxidase (EC 1.11.1.7). (Os10t0109600-01);Peroxidase (EC 1.11. 1.7). (Os10t0109600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0109600-02:1 Os10t0109600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.143577108 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
678204-678201(-) |
| Potential amino acid sequence |
MTFFSVEGMVLSQINQELTTASLHRSNPSNRSYRSSMMSASTQPMLSSYQSGGPYYDVLLGRRD GLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTTDVVVLSEWRPLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |