Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0510700_circ_g.1 |
| ID in PlantcircBase | osa_circ_007639 |
| Alias | Os_ciR4571 |
| Organism | Oryza sativa |
| Position | chr10: 19641665-19642597 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0510700 |
| Parent gene annotation |
Similar to calcium dependent protein kinase1. (Os10t0510700-00) |
| Parent gene strand | - |
| Alternative splicing | Os10g0510700_circ_g.2 Os10g0510700_circ_g.3 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0510700-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.400729868 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19642533-19641685(+) 19642516-19642588(-) |
| Potential amino acid sequence |
MTYVGLLEQHSMHYQQYHLIFHHPEVFNA*(+) MWSIGVITYILLCGSRPFWARTESGIFRSVLRADPNFDDAPWSSISPEAKDFVKRLLNKDYRKR MTAAQALSHPWLRDECRPIPLDMLVFKLIKAYLRSTPFKRAALKALSRAITEDELIYIRAQYNL LEPSSTDGRLCIENFRMMKD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |