Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0119300_circ_g.6 |
| ID in PlantcircBase | osa_circ_026315 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 1001662-1002003 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0119300 |
| Parent gene annotation |
Similar to ESTs AA754121. (Os05t0119300-01);Similar to ESTs AA75 4121. (Os05t0119300-02);Similar to ESTs AA754121. (Os05t0119300- 03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0119200_circ_ag.1 Os05g0119200_circ_igg.1 Os05g0119300_circ_g.1 Os05g0119300_circ_g.2 Os05g0119300_circ_g.3 Os05g0119300_circ_g.4 Os05g0119300_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0119300-03:1 Os05t0119300-02:1 Os05t0119300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015206 |
| PMCS | 0.288492398 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1001920-1001684(+) 1001897-1001997(-) 1001976-1001992(-) |
| Potential amino acid sequence |
MLEKSPLSLSSCLSLPPPIVTHPNQAKLSWCPDDPG*(+) MGILLTRDTLLRATRRRRERTRLLRGLIPLLLGLTLHHLGHTLHSMGTLSLVATLHLVVTPNMV ATLLRATPDHLGTRIA*(-) MGGGKDKHDESDKGLFSNMMHGVAGGHGYPPHQGYPPQGYPPPPGAYPPPPGAYPPPPGAYPPP PGAYPPQHGYPQPGGYPPPGGYPQHGGYPPAGYPGSSGHQDSLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |