Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0509100_circ_g.1 |
ID in PlantcircBase | osa_circ_031018 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 18160217-18164269 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0509100 |
Parent gene annotation |
Serine/threonine protein kinase-related domain containing protei n. (Os06t0509100-01);Similar to Mitogen-activated protein kinase 17. (Os06t0509100-02) |
Parent gene strand | - |
Alternative splicing | Os06g0509100_circ_g.2 Os06g0509100_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0509100-01:8 Os06t0509100-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.111102833 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18164204-18160287(+) 18160336-18163084(-) 18160331-18164256(-) |
Potential amino acid sequence |
MNSGDRASSSSSPSTRTSRRRRANREIQNGELVHKSLVIPPIRWMA*(+) MKCQFVILPYNLLQGYAIHLMGGITSDLWTSSPFWISLFALLLRDVLVDGEDEEDARSPEFMAL RVVAGEDRAVDGLHRRPLLPPPASHPALREGRAFRSRGVSGDLARFHLTMFTPAIDIWSIGCIF AELLTGKPLFPGKNVVHQLDLMTDLLGTPAESLAKIRNEKAR*(-) MPVRDIALQLVAGLCHPSNGRYYQRFVDKLSILDLPICSSST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |