Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0509100_circ_g.1 |
| ID in PlantcircBase | osa_circ_031018 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 18160217-18164269 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0509100 |
| Parent gene annotation |
Serine/threonine protein kinase-related domain containing protei n. (Os06t0509100-01);Similar to Mitogen-activated protein kinase 17. (Os06t0509100-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0509100_circ_g.2 Os06g0509100_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0509100-01:8 Os06t0509100-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111102833 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18164204-18160287(+) 18160336-18163084(-) 18160331-18164256(-) |
| Potential amino acid sequence |
MNSGDRASSSSSPSTRTSRRRRANREIQNGELVHKSLVIPPIRWMA*(+) MKCQFVILPYNLLQGYAIHLMGGITSDLWTSSPFWISLFALLLRDVLVDGEDEEDARSPEFMAL RVVAGEDRAVDGLHRRPLLPPPASHPALREGRAFRSRGVSGDLARFHLTMFTPAIDIWSIGCIF AELLTGKPLFPGKNVVHQLDLMTDLLGTPAESLAKIRNEKAR*(-) MPVRDIALQLVAGLCHPSNGRYYQRFVDKLSILDLPICSSST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |