Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G18890_circ_g.3 |
ID in PlantcircBase | ath_circ_022617 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 6511691-6512102 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT3G18890 |
Parent gene annotation |
Protein TIC 62, chloroplastic |
Parent gene strand | + |
Alternative splicing | AT3G18890_circ_g.1 AT3G18890_circ_g.2 AT3G18890_circ_g.4 AT3G18890_circ_g.5 AT3G18890_circ_g.6 AT3G18890_circ_g.7 AT3G18890_circ_g.8 AT3G18890_circ_g.9 AT3G18890_circ_g.10 AT3G18890_circ_g.11 AT3G18890_circ_g.12 AT3G18890_circ_g.13 |
Support reads | 4 |
Tissues | seedlings |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G18890.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134304733 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6512069-6512099(+) |
Potential amino acid sequence |
MKLQNTDEGTQRPIRASSVVTEASPTNLNSKEEDLVFVAGATGKVGSRTVRELLKLGFRVRAGV RSAQRAGSLVQSVKEMKLQNTDEGTQRPIRASSVVTEASPTNLNSKEEDLVFVAGATGKVGSRT VRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTDEGTQRPIRASSVVTEASPTNLNSKEED LVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTDEGTQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Pan et al., 2017 |