Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G23350_circ_g.3 |
ID in PlantcircBase | ath_circ_014539 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 9944847-9944936 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G23350 |
Parent gene annotation |
Polyadenylate-binding protein 4 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | aerial, inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G23350.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.35759574 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9944856-9944933(+) |
Potential amino acid sequence |
MNGKMVGGKPLYVALAQRKEERRAKLQLNEMNGKMVGGKPLYVALAQRKEERRAKLQLNEMNGK MVGGKPLYVALAQRKEERRAKLQLNEMNGKMVGGKPLYVALAQRKEERRAKLQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |