Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_09G259000_circ_g.3 |
| ID in PlantcircBase | gma_circ_006524 |
| Alias | gma-circRNA1322 |
| Organism | Glycine max |
| Position | chr9: 47759042-47759485 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_09G259000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_09G259000_circ_g.1 GLYMA_09G259000_circ_g.2 GLYMA_09G259000_circ_g.4 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH40447:2 KRH40446:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116601445 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47759392-47759045(+) 47759152-47759447(-) |
| Potential amino acid sequence |
MRMAEAPASSAIFALIVKLHCPRCTKMISPVSY*(+) MVCEANETDVDIGIPAVMLPQDAGENLKNHILNNSVAHWRDHFGAPRTV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |