Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0244400_circ_g.2 |
ID in PlantcircBase | osa_circ_023172 |
Alias | Os_ciR9736 |
Organism | Oryza sativa |
Position | chr4: 9341030-9341371 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0244400 |
Parent gene annotation |
Thioredoxin fold domain containing protein. (Os04t0244400-01);Th ioredoxin fold domain containing protein. (Os04t0244400-02) |
Parent gene strand | + |
Alternative splicing | Os04g0244400_circ_g.3 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0244400-02:2 Os04t0244400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.361115521 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9341333-9341045(+) 9341132-9341045(+) |
Potential amino acid sequence |
MIKPLMKRKKNGAAFLDYHDIPYKVVEVNPLSKKEIKWSEYKKVPILMVDGEQLVDSSDIINIL QQRVRPDDKATNEEEEKWRSFPRLS*(+) MVDGEQLVDSSDIINILQQRVRPDDKATNEEEEKWRSFPRLS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |