Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0156600_circ_g.3 |
| ID in PlantcircBase | osa_circ_026668 |
| Alias | Os_ciR10191 |
| Organism | Oryza sativa |
| Position | chr5: 3310366-3310766 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0156600 |
| Parent gene annotation |
Similar to Tubulin gamma-1 chain (Gamma-1 tubulin). (Os05t015660 0-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0156600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.864061409 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3310654-3310509(+) 3310766-3310739(-) |
| Potential amino acid sequence |
MAGQQHHLFPSDLGKHCMSGQAFCCIGHSESPTGKNPYLSFNSQWSVTCHQKMTPWSRDQRGKK ANQVIVHISRIPQSSCACRHNC*(+) MGSYLLETLNDRYSKKLVQTYSVFPNQMETSDVVVQPYNSLLTLKRLTLNADCVVVLDNTALNR IAVERLHLANPTFAQTNSLVSTVMSASTTTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPL TVERQVWVLTCWRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |