Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0581300_circ_g.3 |
ID in PlantcircBase | osa_circ_002331 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 22537185-22537925 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0581300 |
Parent gene annotation |
Similar to Lycopene epsilon-cyclase (Fragment). (Os01t0581300-01 ) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0581300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002162* osi_circ_010188 |
PMCS | 0.221728025 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22537216-22537201(+) |
Potential amino acid sequence |
MVFMDYRDCFKDKFSHPEQGNPTFLYAMPMSSTRIFFEETCLASKEAMPFDLLKKRLMSRLDAM GVHIRKVYEEEWSYIPVGGSLPNTDQKNLAFGAAASMVHPATGYSVVRSLSEAPRYASVISDIL RNRVYPGEYLPGTSQSSSPSMLGGKQSI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |