Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0799300_circ_g.1 |
ID in PlantcircBase | osa_circ_016967 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 34042763-34043193 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0799300 |
Parent gene annotation |
Similar to H0306F03.12 protein. (Os02t0799300-01);Similar to pre dicted protein. (Os02t0799300-02) |
Parent gene strand | + |
Alternative splicing | Os02g0799300_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0799300-02:1 Os02t0799300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.103441609 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34042931-34042763(+) |
Potential amino acid sequence |
MASVGYTAFPLFIIALVWFVLFFLVMLGICCKHCCCPHRSYTYSRVAYALSLILLILFTCAAI* (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |