Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G051400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001088 |
| Alias | Chr10:5867645|5868053 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 5867645-5868053 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G051400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.010G051400.2:3 Gorai.010G051400.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199946842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5867884-5868004(-) 5867898-5867699(+) 5867987-5867676(+) |
| Potential amino acid sequence |
MKICLCCQLMLFFLKIPLSRYMLRNTLKIKRHYSRIMQRHIPNLATLGPNLILQRKMGQEHQED SLGQCNG*(-) MSLKYELSNFNHCTVQDCPPGVPGPSFSGGSNLAPRLLSLVCASA*(+) MNCQTSTIALSKTVLLVFLAHLSLEDQIWPQGC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |