Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0265100_circ_g.4 |
ID in PlantcircBase | osa_circ_019003 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8738712-8739755 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0265100 |
Parent gene annotation |
Glycosyl transferase, group 1 domain containing protein. (Os03t0 265100-01) |
Parent gene strand | + |
Alternative splicing | Os03g0265100_circ_g.1 Os03g0265100_circ_g.2 Os03g0265100_circ_g.3 Os03g0265100_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0265001-01:1 Os03t0265100-01:5 Os03t0265001-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.198307168 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8738740-8738757(+) |
Potential amino acid sequence |
MLSVPMVMSYHTHLPAYIPRYNLNWLLGPTWSLIRCLHRSADLTLVPSVAIAEDFETAKVVSAN RVRLWNKGVDSESFHPKFRKHEMRIKLSGGEPEKPLIIHVGRFGREKNLDFLKRFLVLALSQRC FQSQW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |