Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0495000_circ_g.4 |
| ID in PlantcircBase | osa_circ_033887 |
| Alias | Os_ciR10945 |
| Organism | Oryza sativa |
| Position | chr7: 18513357-18514051 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0495000 |
| Parent gene annotation |
RmlC-like jelly roll fold domain containing protein. (Os07t04950 00-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0495000_circ_g.1 Os07g0495000_circ_g.2 Os07g0495000_circ_g.3 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0495000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122421775 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18513718-18513366(+) |
| Potential amino acid sequence |
MDFQPGEYLNVKEVHYNQHGLLLLEGQGIYRLGDSWYLS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |