Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0641100_circ_g.9 |
| ID in PlantcircBase | osa_circ_012553 |
| Alias | Os_ciR7518 |
| Organism | Oryza sativa |
| Position | chr12: 27505398-27505593 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0641100 |
| Parent gene annotation |
Similar to Na+/H+ antiporter. (Os12t0641100-01);Similar to Na+/H + antiporter. (Os12t0641100-02);Plasma membrane Na+/H+ antiporte r, Salt stress (Os12t0641100-03);Plasma membrane Na+/H+ antiport er, Salt tolerance (Os12t0641100-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0641100-04:2 Os12t0641100-03:2 Os12t0641100-02:2 Os12t0641100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.303412372 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27505554-27505431(+) 27505404-27505403(+) 27505556-27505562(-) 27505460-27505433(-) |
| Potential amino acid sequence |
MTVKTPETSSASCARNDASFADCHP*(+) MMQALLTVTLKSSFCKSGIEHSQCHDGQNTRDLQCILCQK*(+) MTLGMFYAAFAKTAFKGDSQQSLHHFWHKMHWRSLVF*(-) MPLLQKLLLRVTVSKACIISGTRCTGGLWCFDRHDTGNVLCRFCKNCF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |