Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G55020_circ_g.2 |
| ID in PlantcircBase | ath_circ_027588 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 20390044-20390145 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G55020 |
| Parent gene annotation |
Ypt/Rab-GAP domain of gyp1p superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G55020_circ_g.3 AT3G55020_circ_g.4 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G55020.1:1 AT3G55020.3:1 AT3G55020.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.318707027 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20390140-20390046(-) |
| Potential amino acid sequence |
MRVEQEQKVTEDARIFAEQDAEAQRYAAQVLQVLMRVEQEQKVTEDARIFAEQDAEAQRYAAQV LQVLMRVEQEQKVTEDARIFAEQDAEAQRYAAQVLQVLMRVEQEQKVTEDARIFAEQDAEAQRY AAQVLQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |