Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0457600_circ_g.2 |
| ID in PlantcircBase | osa_circ_006994 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 16777679-16777969 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0457600 |
| Parent gene annotation |
Similar to Acetyl-CoA C-acyltransferase (3-ketoacyl-coa thiolase b) (EC 2.3.1.16) (Fragment). (Os10t0457600-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0457600_circ_g.1 |
| Support reads | 19 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0457600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.233470704 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16777719-16777966(+) |
| Potential amino acid sequence |
MGLTSENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPVHTKVELFSQARDCLLPMG LTSENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPVHTKVELFSQARDCLLPMGLT SENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPVHTKVELFSQARDCLLPMGLTSE NVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPVHTK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |