Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0730700_circ_g.1 |
| ID in PlantcircBase | osa_circ_016401 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30438458-30439602 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0730725 |
| Parent gene annotation |
Hypothetical protein. (Os02t0730725-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0730700_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0730700-02:5 Os02t0730725-00:3 Os02t0730700-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141413581 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30439435-30439522(-) |
| Potential amino acid sequence |
MFLGDDYVPRWGMTSTPIRSAPDNLFHTEAQKVYYGDQQLSMRGASGNSVQVIFDSGSSYTYLP DEIYKNLIAAIKYAYPNFVQDSSDRTLPLCLATDFPVRYLEDVKQLFKPLNLHFGKRWFVMPRT FTILPDNYLIISDKGNVCLGFLNGKDIDHGSTVIVGGVHMISKASFWPHQLRPMGSLVLVVQE* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |