Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0158200_circ_g.1 |
| ID in PlantcircBase | osa_circ_000401 |
| Alias | Os_ciR2738 |
| Organism | Oryza sativa |
| Position | chr1: 3055633-3056203 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0158200 |
| Parent gene annotation |
Similar to Serine carboxypeptidase II-1 precursor (EC 3.4.16.6) (CP-MII.1) (Fragment). (Os01t0158200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0158200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123029189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3056096-3055652(+) 3055830-3056138(-) 3055664-3056161(-) |
| Potential amino acid sequence |
MIPALKSTLRSTTTYQKCKKHFMPMSLEYRMPGPPAGWKCGNR*(+) MHQCSLVQPQPLHKSCYMLLMREQMIQNHRPPAASDMYHQISARVSTSTQMCQRSHGNHRLPHF QPAGGPGIRYSSDIGMKCFLHFW*(-) MVIIDYRISNLQVVQAYGIPVTLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |