Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0158200_circ_g.1 |
ID in PlantcircBase | osa_circ_000401 |
Alias | Os_ciR2738 |
Organism | Oryza sativa |
Position | chr1: 3055633-3056203 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0158200 |
Parent gene annotation |
Similar to Serine carboxypeptidase II-1 precursor (EC 3.4.16.6) (CP-MII.1) (Fragment). (Os01t0158200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0158200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.123029189 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3056096-3055652(+) 3055830-3056138(-) 3055664-3056161(-) |
Potential amino acid sequence |
MIPALKSTLRSTTTYQKCKKHFMPMSLEYRMPGPPAGWKCGNR*(+) MHQCSLVQPQPLHKSCYMLLMREQMIQNHRPPAASDMYHQISARVSTSTQMCQRSHGNHRLPHF QPAGGPGIRYSSDIGMKCFLHFW*(-) MVIIDYRISNLQVVQAYGIPVTLA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |