Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0578600_circ_g.3 |
| ID in PlantcircBase | osa_circ_034527 |
| Alias | Os_ciR11049 |
| Organism | Oryza sativa |
| Position | chr7: 23420070-23420509 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0578600 |
| Parent gene annotation |
Similar to 5-formyltetrahydrofolate cycloligase (EC 6.3.3.2). (O s07t0578600-01);Similar to 5-formyltetrahydrofolate cyclo-ligase . (Os07t0578600-02);Similar to 5-formyltetrahydrofolate cyclo-li gase. (Os07t0578600-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0578600_circ_g.1 Os07g0578600_circ_g.2 Os07g0578600_circ_g.4 Os07g0578600_circ_g.5 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0578600-02:3 Os07t0578600-03:3 Os07t0578600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297084564 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23420127-23420112(+) 23420082-23420207(-) |
| Potential amino acid sequence |
MRMLKITTMDDLVKNSMNILEPSPLDASGNAREEVLSTSSPVDLFLLPGQAFDRTGRRLGRGGG TWTCKGSLCSSSGR*(+) MSMFLHHVLIFVQSYQKLVQAIEKDQQGKRLTTLLHEHSH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |