Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0354400_circ_g.2 |
| ID in PlantcircBase | osa_circ_027525 |
| Alias | Os05circ08369/Os_ciR936 |
| Organism | Oryza sativa |
| Position | chr5: 16782938-16783669 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
| Parent gene | Os05g0354400 |
| Parent gene annotation |
Similar to ESK1 (ESKIMO 1). (Os05t0354400-01);Similar to ESK1 (E SKIMO 1). (Os05t0354400-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0354400_circ_g.1 Os05g0354400_circ_g.3 Os05g0354400_circ_g.4 Os05g0354400_circ_g.5 Os05g0354400_circ_g.6 Os05g0354400_circ_g.7 |
| Support reads | 3/17/8 |
| Tissues | leaf and panicle/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0354400-02:1 Os05t0354400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006182* |
| PMCS | 0.615542812 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16783602-16783629(-) 16783011-16783629(-) |
| Potential amino acid sequence |
MHSIVDRIIKPTSIAKHAANWEGVDYLIFNTYIWWMNTPEMKILHGGSFSKKPVKYDEMERVAA YRKVLKTWSRWVEKHVDPKRSTVFFMSVSPVHMQSTMLLSSSIGHLF*(-) MGRKACRSEKKYSLLHECLTCAYAEYNATIEFYWSPFLVESNSDDPNMHSIVDRIIKPTSIAKH AANWEGVDYLIFNTYIWWMNTPEMKILHGGSFSKKPVKYDEMERVAAYRKVLKTWSRWVEKHVD PKRSTVFFMSVSPVHMQSTMLLSSSIGHLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |