Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G129900_circ_g.2 |
| ID in PlantcircBase | gra_circ_000621 |
| Alias | Chr06:38371095|38374267 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 38371095-38374267 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G129900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.006G129900_circ_g.1 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G129900.1:8 Gorai.006G129900.2:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.48349917 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38373967-38371121(+) 38371270-38374171(-) |
| Potential amino acid sequence |
MSTCSIQYRKLDFEEFCASAVSVHQLEGMETWEQHARRAYDLFDKDGNRPIMIEELASIVQGWR TSR*(+) MTALASSSGYFPPLESILSRSSPPLHNRGKFLYHNGPVSVLIKQIICTPCMLFPCFHSF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |