Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d003800_circ_g.2 |
| ID in PlantcircBase | zma_circ_007185 |
| Alias | Zm02circ00053, zma_circ_0000746, GRMZM2G074238_C1 |
| Organism | Zea mays |
| Position | chr2: 59827311-59827572 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d003800 |
| Parent gene annotation |
alpha/beta-Hydrolases superfamily protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d003800_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d003800_T006:1 Zm00001d003800_T003:1 Zm00001d003800_T001:1 Zm00001d003800_T005:1 Zm00001d003800_T004:1 Zm00001d003800_T002:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.339472932 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
59827447-59827339(+) 59827556-59827339(+) 59827348-59827323(-) |
| Potential amino acid sequence |
MRDPDRPLVPRELLVPGVPRHVRRQAGPPVVAYGAENGHAGEPCRLYSQTWP*(+) MATPESHVGSIAKLGHEHLVLLGQEGRVVGDDAGGREELLGVPPVGEPRQVMRDPDRPLVPREL LVPGVPRHVRRQAGPPVVAYGAENGHAGEPCRLYSQTWP*(+) MLMAKFGYRAYMALRRGHSRPRRQLLVARLAVERVAGRLVPAAPSGPVGGLGRASPAVAHLLVE HPEALPGLQRHRLQPCPPVPRGRDAHGQVWL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |