Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc09g014300.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002818 |
| Alias | 9:5793547|5793920 |
| Organism | Solanum lycopersicum |
| Position | chr9: 5793547-5793920 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI, circseq_cup |
| Parent gene | Solyc09g014300.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc09g014300.2_circ_g.1 |
| Support reads | 7 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc09g014300.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.410156676 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5793919-5793549(-) |
| Potential amino acid sequence |
MVVTTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDIIHASSPGIMVM VVTTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDIIHASSPGIMVMV VTTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDIIHASSPGIMVMVV TTHEGVPEEFYGAKLIGSRSFPCPCYAKVPLSLALSPRIISEVAQFKPDIIHASSPGIM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Tan et al., 2017; Yin et al., 2018 |