Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0310800_circ_g.1 |
| ID in PlantcircBase | osa_circ_009172 |
| Alias | Os_ciR7017 |
| Organism | Oryza sativa |
| Position | chr11: 11909654-11917331 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os11g0310800 |
| Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os11t 0310800-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0310800_circ_g.2 Os11g0310800_circ_g.3 Os11g0310800_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0310800-01:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.329153959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11910777-11909658(+) |
| Potential amino acid sequence |
MKRLIKDRASDLKVLITSATLDGLKVSKFFSGCPVLNIPGTLFPVEKFYSTEHPTNYIESSLRT AIDIHVKESPGDVLIFMTGKDDIDKMVSKLEERIQNLEEGSCMDALVLPLHGSLPPEQQVRVFA PAPPNCRRFIVATNVAETSLTVDGVVFVIDCGYVKQRQYNPSSGMYSLDVVQISRVQADQRAGR AGRTRPGKCYRLYPISIYQKEFLEATIPEIQRSSLAGSVLYLKSLDLPDINILKFDFLDPPSRE SLEDALRQLYLIDAIDENGQITDVGRIMAGE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |