Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0372800_circ_g.1 |
| ID in PlantcircBase | osa_circ_039017 |
| Alias | Os_ciR11759 |
| Organism | Oryza sativa |
| Position | chr9: 12433723-12433865 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0372800 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os09 t0372800-01);Serine/threonine protein kinase domain containing p rotein. (Os09t0372800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0372800-01:1 Os09t0372800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.414331235 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12433855-12433779(+) 12433850-12433847(-) |
| Potential amino acid sequence |
MSHPLNCYHGMIKKRKQVRMVEQ*(+) MKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKRMGHML*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |