Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0179000_circ_g.1 |
ID in PlantcircBase | osa_circ_018197 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4154181-4154756 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0179000 |
Parent gene annotation |
Similar to Tubulin-tyrosine ligase family protein, expressed. (O s03t0179000-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0179000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185654369 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4154189-4154239(+) |
Potential amino acid sequence |
MDELGSAMRHSDDANFRIAPFLFMPDGKLASAISYTILWPVHDVHTGEECTRDFLFGVGEDKQR SARLTAWFHTPENYFIQEFRKYKEQLQSSSICPSRKVTPVTKSIRPSDGHALRVFTDIPQVEEF LTRPEFVLSMSWMSWVQLCATVTMQTSE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |