Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G65790_circ_g.1 |
| ID in PlantcircBase | ath_circ_008834 |
| Alias | AT1G65790_C1, AT1G65790_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 24471127-24471337 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G65790 |
| Parent gene annotation |
Receptor-like serine/threonine-protein kinase SD1-7 |
| Parent gene strand | + |
| Alternative splicing | 1_circ_ag.2 1_circ_ag.2 1_circ_ag.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G65790.3:1 AT1G65790.1:1 AT1G65790.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.368389728 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24471176-24471137(+) |
| Potential amino acid sequence |
MSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFGKIT* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |